PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC13382_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 337aa    MW: 37279.3 Da    PI: 6.2363
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC13382_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.77e-10148197554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   + 
  RrC13382_p1 148 KRAKRILANRQSAARSKERKARYIQELERKVQSLQTEATTLSAQLTLFQR 197
                  9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-16144208IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909146209IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-10148202No hitNo description
PfamPF001703.4E-8148196IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-10148199No hitNo description
CDDcd147031.49E-22149198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDKSDPQQPK PTTDPHPNPN ADPTPSSFHR RSRSDDMSMF MFMDPLSSAG PPPSSDDLPS  60
DDDLFSSFID VDSLSSNPHP AIAFPNHHAS NSNSVVVSGA VPSSSSRPRH RHSNSVDAGC  120
AMYANEIMDA KKAMPPEKLS ELWNIDPKRA KRILANRQSA ARSKERKARY IQELERKVQS  180
LQTEATTLSA QLTLFQRDTN GLANENTELK MRLQAMEQQA HLRNALNEAL RKELERMKIE  240
TGEISGNSDS FDMGMQQVQY SPSTFMAIPP YHHGQDMQQM HGFNPSHPME AMSNSQSVSE  300
FLQNGRMQGL EISSNNSSSL VKSEGPSLSA SESSSAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118474.11e-173PREDICTED: transcription factor RF2b
RefseqXP_013602256.11e-173PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P43e-82RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078FA861e-173A0A078FA86_BRANA; BnaC08g44990D protein
TrEMBLA0A0D3DYP41e-173A0A0D3DYP4_BRAOL; Uncharacterized protein
TrEMBLM4ERW41e-173M4ERW4_BRARP; Uncharacterized protein
STRINGBra031541.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-123basic leucine-zipper 52